SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000242462 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000242462
Domain Number 1 Region: 81-147
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.37e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000242462
Sequence length 215
Comment NEUROG3 (Homo_sapiens) neurogenin 3
Sequence
MAPQPLGAPSIRVTRETEQPFPGASDNEILSAASAPPSPTLIPRDRAEPEAGGCQGAARK
LRARRGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDEAKLT
KIETLRFAHNYIWALTQTLRLADHIFYRPEAPAASCAELGSPEGGSPGDWGSLYSPVSHA
GSLSPAASLEERPGLRAPTSPACLHSGALAFADCL
Download sequence
Identical sequences G5B187
HGL_H00000242462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]