SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000242728 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000242728
Domain Number 1 Region: 41-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000183
Family HLH, helix-loop-helix DNA-binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 125-172
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000000759
Family Hairy Orange domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000242728
Sequence length 225
Comment BHLHE41 (Homo_sapiens) basic helix-loop-helix family, member e41
Sequence
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDSKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQSDLDAFHSGFQTCAKEVLQYLARFESWTPREPRCVQLINHLHAVATQFLPTPQLL
TQQVPVSKGGGAASAAAPVGSLERAGQKLEPLAHCVPVIQRTQAG
Download sequence
Identical sequences G5BQA4
HGL_H00000242728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]