SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000244571 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000244571
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.76e-71
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000187
Further Details:      
 
Domain Number 2 Region: 573-735
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.01e-30
Family AlaX-like 0.045
Further Details:      
 
Domain Number 3 Region: 207-320
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 9.81e-29
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00065
Further Details:      
 
Domain Number 4 Region: 494-569
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000883
Family AlaX-M N-terminal domain-like 0.0079
Further Details:      
 
Domain Number 5 Region: 345-434
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000000017
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000244571
Sequence length 947
Comment AARS2 (Homo_sapiens) alanyl-tRNA synthetase 2, mitochondrial (putative)
Sequence
MNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGRHNDLEDVGRDLSHHTFFEMLGNWA
FGGEYFKEEACTMAWELLTRVYGIPEDRLWVSYFGGDPKAGLDPDLESRDIWLSLGVPSN
HVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGVGAPQLVELWNLVFMQHNREADRSLQP
LPQQHVDTGMGLERLVAVLQGRCSTYDTDLFSPLFHAIHQGCGAPPYLGRVGAADEGHTD
TAYRVVADHIRTLSVCIADGVSPGMSGAPLVLRRILRRAVRFSTEVLRAPPGLLGSLVPV
VVETLGDAYPELQRNSAQVENPGDGRAVEKGFLQGTQLHCLLPGQIASLVSEDEAAFLDS
LQRGRRIIDRTLKRLGPSDLFPADVAWSLSLSGNLGLPLDLVELMLEEKGVQLDSAGLAQ
LVQEEAQLRAHQAEPAQEQRLCLNLHALGELQHRGMTPTDDSPKYSYSLQPTGEYEFGPC
EAQVLQLYTEDGAAVATVGPGQRCGLLLDRTNFYAEQGGQASDRGYLVRAGHQDVLFPVA
QAQVWGGFILHEVLASEHLQVGDKVQLHVDKAWRLGCMEKHTATHLLSWALRQTLGPSTE
QRGSHLNPEWLRFDVATQAPLTPEQLRTVEGTVQEAVQQDEAVYTAEVPLVLTACVPGLR
SLDEVYPDPVRVVSVGVPVARALDPMSQAALQASVELCCGTHLLRTGAVGDLVIIRESQL
TKGTTRLLVITGEQAQQVSTAVGRGDFRVWAREVGKSLAQEVDVAAERLNRGSRDLVEAH
QLSKDVGRLTKAMDRAVMPQWQRRELQARLKLLQRHANTAIRKLELAQAAVKSQELLKQH
EKGPLIVDTVSAQSLSVLVKVVRQLCERAPGTSVLLLSPQPVGSVLCACQVAQGATPAFT
AVAWALAVCSQMGGKAWGSHVVAQGTGRTMDLDAALSAARAYALNQL
Download sequence
Identical sequences G5BNP3
HGL_H00000244571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]