SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000245907 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000245907
Domain Number 1 Region: 977-1265
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.67e-94
Family Complement components 0.00000000054
Further Details:      
 
Domain Number 2 Region: 1492-1641
Classification Level Classification E-value
Superfamily TIMP-like 1.49e-48
Family Netrin-like domain (NTR/C345C module) 0.00098
Further Details:      
 
Domain Number 3 Region: 1338-1493
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.96e-39
Family Alpha-macroglobulin receptor domain 0.00042
Further Details:      
 
Domain Number 4 Region: 654-721
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 1.05e-18
Family Anaphylotoxins (complement system) 0.0017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000245907
Domain Number - Region: 802-852
Classification Level Classification E-value
Superfamily E set domains 0.035
Family SVA-like 0.051
Further Details:      
 
Domain Number - Region: 373-412
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0746
Family Pre-dockerin domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000245907
Sequence length 1643
Comment C3 (Homo_sapiens) complement component 3
Sequence
MGPASGPSLLLLLASLPLALGDPMYSIITPNILRLENEETIVLEAHEVQGNVPVTVTVHD
FPAKKQVLSSEKTVLTSATGHLGTVTIKIPSSKEFRSDKGHKFVIVQAAFGGTQLEKVVL
VSLQSGYLFIQTDKTIYTPGSTVLYRIFTVDHDLLPVGRTVIVIIETPDGIPIKRDTLSS
HNQYGILPLSWNIPELVNMGQWKIQAFYEHSPKQVFSAQFEVKEYVLPSFEVVVEPGEKF
YYIDDPRGLEVNIMARFLYGKNVDGTAFVIFGIQDGDQRISLAQSLTRVVIEDGSGEAVL
SRQVLLDGVQPSNAAALVGKSLYVSVTVILHSGSDMVEAERSGIPIVTSPYQIHFTKTPK
YFKPAMPFDLMVFVTNPDGSPAPHVPVVIQGTNVQSLTQDDGVAKLSINTPNNRQPLSIT
VRTKKEGILEARQATNTMQALPYSTMHNSNNYLHLSMPRSELKPGETINVNFHLRADATQ
EAKIRYYTYLVMNKGKLLKAGRQAREPGQDLVVLPLTITKDFIPSFRLVAYYTLVGASGQ
REVVADSVWVDVKDSCVGTLVVKGGGEEEKSQHLPGQQMTLRIEGNQGARVGLVAVDKGV
FVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFADAGLSLKTSKGLQTAQRGAGQY
QNKELRKCCEDGMRENPMQFSCQRRARYVDVSAGLREACVKAFLDCCTYLAELRRQRARD
RKLGLARSDLDEDIIPEEDIISRSQFPESWLWAIEELKDPEKNGISTKTMNIFLKDSITT
WEILAVSLSDKKGICVADPYEVTVVQDFFIDLRLPYSVVRNEQVEIRAVLYNYREDQSLK
VRVELLHNPAFCSLATAKKRHYQTVTIPPKSSLPVPYVIVPLKTGLQEVEVKAAVYNHFI
SDGVKKTLKVVPEGIRVNKTVAVRTLDPEHLGQDGVQREEVPPADLSDQVPDTDSETRIL
LQGTPVAQMTEDAVDGERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDQTEQWEKFGLEK
RQAALDLIKKGYTQQLAFRQPSSAYAAFLNRNPSTWLTAYVVKVFSLAVNLIAIDSQVLC
GAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRNTQEAEVSLTAFVLIALQEAKEICEGQ
VNSLPNSINKAGDYIASNYANLQRPYTVAIAGYALAQLDKLGGPLLVKFRSAATEKNRWE
EAGQKLYSVEATSYALLALLLLRDFDSVPPVARWLNEQRYYGGGYGSTQAATFMVFQALA
QYQTDIPDHKDLNMEVALQLPSRSSLVKHRLLWDIGGLLRSEETKQNEGFTLTAKGKGQG
TLSVVTMYHAKVKGKVTCKKFDLRVTVSPAPDTVKKPQDAKSTMILGICAKYLGDQDATM
SILDIAMMTGFVPDTDDLKLLSTGVDRYISKYELDKAFANKNTLIIYLDKLSHSEEECLS
FKIHQFFNVGLIQPGSVKVYSYYNLDETCTQFYHPEKEDGMLSKLCHKDLCRCAEENCFM
HQADEKVTLDERLEKACEPGVDYVYKTKLVKMELSDDFDEYIMTIEQVIKSGSDEVQAGQ
ERRFISHVKCRDALRLKDGKHYLMWGVSSDLWGEKPNISYIIGKDTWVELWPEAEECQDE
ENQKQCQELGAFTESMVVFGCPN
Download sequence
Identical sequences G5C0N5
HGL_H00000245907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]