SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000246957 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000246957
Domain Number 1 Region: 297-554
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.16e-73
Family Hsp90 middle domain 0.00000452
Further Details:      
 
Domain Number 2 Region: 88-295
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.23e-61
Family Heat shock protein 90, HSP90, N-terminal domain 0.00000839
Further Details:      
 
Domain Number 3 Region: 583-700
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 2.09e-27
Family HSP90 C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000246957
Sequence length 706
Comment TRAP1 (Homo_sapiens) TNF receptor-associated protein 1
Sequence
MAREFRVLLLWSRTVRPPLRAPVLAAVSGGKPVLCPQRSTVQFRSPWQQLSSSFYARQLY
STQAAEDKKEEPLHSIISSSEVVQGSISKHEFQAETKKLLDIVACSLYSEKEVFIRELIS
NASDALEKLRHKLVSDGQTLPEMEIHLQTDTEKGIITIQDTGIGMTQEELVSNLGTIARS
GSKAFLEALQDQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGV
FEIAEASGVRTGTKIIIHLKSDCREFASEARVRDVVTKYSNFISFPLYLNGRRINTLQAI
WMMEPKELNELQHEQFYRYIAQAYDKPRYTLHYKTDAPLNIRSIFYVPETKPSMFDVSRE
LGSSVALYSRKVLIQTKAADILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVL
QQRLIKFFIDQSKKDPEKYAKFFEDYSLFMREGIVTTTEQEVKEEIAKLLRYESSALPAG
QLASLSDYASRMQAGTRNIYYLCAPTRHLAEHSPYYEAMKQKNTEVLFCYEQFDELTLLH
LREFDKKKLISVETDIVVDHYKEEKFEDASPAGECLSEKETEELMAWMRNVLGSRVTNVK
VTLRLDTHPAMVTVLEMGAARHFLRMQQLARTQEERAQLLQPTLEINPRHTLIRKLSDLR
QREPELAQLLVDQIYENAMIAAGLVDDPRPMVGRLNDLLVKALEKH
Download sequence
Identical sequences G5B1G7
HGL_H00000246957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]