SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000250003 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000250003
Domain Number - Region: 81-103
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0556
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000250003
Sequence length 253
Comment MYOD1 (Homo_sapiens) myogenic differentiation 1
Sequence
MELLSPPLRDVDLTGPDGSLCSFVTADDFYDDPCFDSPDLRFFEDLDPRLVHVGALLKPE
EHSHFPAAVHPASGAREDEHVVEILRNAIRYIEGLQALLRDQDAAPPGAAAFYAPGPLPP
GRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYDGACYSEAPSEPRPGKGAAV
SSLDCLSSIVQRISTESPAAPALLQADAPPESPPRQQEAAAPSEGELGAPTPSPDATSQG
PSGANPNPIYQVL
Download sequence
Identical sequences G5BNQ1
HGL_H00000250003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]