SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000252951-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000252951-3
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Globin-like 8.13e-33
Family Globins 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000252951-3
Sequence length 104
Comment HBZ (Homo_sapiens) hemoglobin, zeta
Sequence
IMSLTNSERAIITTIWDKMSMQADVIGTETLERLFSSYPQTKTYFPHFDLHPGSPQLRAH
GSKVMAALGDAVKNIDNVEVALTKLSELHAYVLRVDPVNFKVGG
Download sequence
Identical sequences G5CB64
HGL_H00000252951-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]