SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000253778-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000253778-1
Domain Number 1 Region: 254-595
Classification Level Classification E-value
Superfamily SIS domain 2.32e-50
Family double-SIS domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 8-83,161-205
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000000000000337
Family Class II glutamine amidotransferases 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000253778-1
Sequence length 595
Comment GFPT2 (Homo_sapiens) glutamine-fructose-6-phosphate transaminase 2
Sequence
MSNPVFQESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVF
KSLHYPGEAVATRRGSPLLIGVRSKYKRSTEQIPVVYRTCNVENVKNICKKRMKRLDSST
CLHAVGDKAMEFFFASDARPTPGTLPAMQTACDALAGLACAQGLCGASSVVTADPSAIIE
HTNRVIFLEDDNIATVADGKLSIHRVKCSASDDPSPAIQTLQVELQQIMKGRILFPHFTV
LCTALSQAADVREGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTGNPKTRQDPPVLHPT
RQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFISQSGETADTLLALRYRGRHQHRGR
LHLARDRLRRPHQRGSEIGVASTKAYTSQFISLVMFGLMMSEDRISLQNRRQEITRGLRS
FPELIREVLSLEEKIHDLALELYTQRSLLVMGRGYNYAMCLEGALMSTPAHPPSIPPCRL
RRERQIASSAPIPLLTPKAILAGELKHGPLALIDKQMPVIMVIMKDPCFAKCQNALQQVT
AHQGRLIMLCCKVDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRG
Download sequence
Identical sequences G5AT70
HGL_H00000253778-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]