SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000255189 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000255189
Domain Number 1 Region: 443-733
Classification Level Classification E-value
Superfamily Folate-binding domain 4.08e-83
Family Aminomethyltransferase folate-binding domain 0.000031
Further Details:      
 
Domain Number 2 Region: 18-231,342-404
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-56
Family FAD-linked reductases, N-terminal domain 0.00032
Further Details:      
 
Domain Number 3 Region: 231-341
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.77e-29
Family L-aminoacid/polyamine oxidase 0.005
Further Details:      
 
Domain Number 4 Region: 736-821
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 6.38e-22
Family Aminomethyltransferase beta-barrel domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000255189
Sequence length 832
Comment DMGDH (Homo_sapiens) dimethylglycine dehydrogenase
Sequence
EENLPLSAETQWKDRAETVIIGGGCIGVSLAYHLAKAGMRDVVLLEKSELTAGSTWHAAG
LTTYFHPGINLKKIHYDSIKLYEKLEEETGQVVGFHQPGSIRIATTPVRVDEFKYQMTRT
GWQATEQYIIGPEKIQEMFPLLNMDKILAGLYNPGDGHIDPYSLTMALAAGARKYGALLK
YPAPVTSLKPRLDGTWDVETPQGSITANRIVNAAGFWAREVGAMIGLEHPLIPVQHQYVV
TSTIPEVQALKQELPVLRDLEGSYYLRQERDGLLFGPYESQEKMKVQDTWVTSGVPPGFG
KELFESDLDRIMEHVEAAMEMVPVLKKADIISVVNGPITYTPDILPMVGPHQGVRNYWVA
VGFGYGIIHAGGAGKYLSDWILQGEPPFDLIELDPNRYAKWTTAQYTEAKARESYGFNNI
VGYPKEERLAGRPTQRVSGLYQALAPKCSMGFHAGWEQPNWFYRPGQDTQYRPSFRRTNW
FEPVGSEYKQVTQKVGVIDLTPFGKFHIKGQHSVRLLDHLVANVIPKVGFTNISHMLTPR
GRVYAELTVSHQSPGEFLLITGSGSELHDLRWIEEVANKGGYDVEIRNITDELGVLGVAG
PHSRRVLQKLTSEDLSESAFKFLQSKSFKVSGIPVTAIRISYTGELGWELYHRPEDSAPL
YEAIMNSGQQEGIDNFGTYALNALRLEKAFRAWGAEMNCDTNPLEAGLEYFVKLNKPADF
IGKQALKQIKAEGLTRRLVCLTLATDDVDPEGNESIWFHGKVVGNTTSGSYSYSIQKSLA
FAYVPIELSEVGQQVEVELLGKNYPATVIQEPLVLTEPTRNRLEKKGGKDKT
Download sequence
Identical sequences G5ASU2
HGL_H00000255189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]