SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000256495 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000256495
Domain Number 1 Region: 49-124
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000458
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 139-181
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000034
Family Hairy Orange domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000256495
Sequence length 412
Comment BHLHE40 (Homo_sapiens) basic helix-loop-helix family, member e40
Sequence
MERIPSAQPPPACLPKAPVLEHGDLPGMDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA
LQSGLQTGELSGRNVEANQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVMHLHRVVS
ELLQGGTSRKPSDPSPKVMDFKEKPSSLAKGSEGPGKNCVPVIQRTFAPSSGEQSGSDTD
TDSGYGGESEKGDLRSEQPYFKSDHGRRFTMGEQVSTIKQESEEPPTKKSRMQLSDDEGH
FTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAA
ALSSFMNPDKISAPLLMPQRLPSPLSAHPSLDSSALLQALKQIPPLSLETKD
Download sequence
Identical sequences G5B3I0
XP_004854296.1.39548 HGL_H00000256495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]