SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000257177 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000257177
Domain Number 1 Region: 1116-1288
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.29e-47
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0088
Further Details:      
 
Domain Number 2 Region: 516-577,640-736
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.62e-40
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.069
Further Details:      
 
Domain Number 3 Region: 971-1112
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.92e-35
Family Poly(A) polymerase, PAP, N-terminal domain 0.021
Further Details:      
 
Domain Number 4 Region: 359-549
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.36e-27
Family RNA editing terminal uridyl transferase 2, RET2, catalytic domain 0.072
Further Details:      
 
Domain Number 5 Region: 1308-1336
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000436
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Domain Number 6 Region: 1369-1400
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000119
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Weak hits

Sequence:  HGL_H00000257177
Domain Number - Region: 932-956
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000238
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000257177
Sequence length 1668
Comment ZCCHC11 (Homo_sapiens) zinc finger, CCHC domain containing 11
Sequence
METPKTSKSENHEPKNVICEESKPVKVITNQTLKARNDKSVKEIGSSPSNRNSSKKTKQN
DTCVEKTEVKSWKVNAASVPGPKDLGLVLRDQSHCKGKKLPNSPVKAEKIPSSTSQAKLE
KAPNLQAKVEKVPKSPNLPAKAEKVPCSTATAAAGKSLSSQRKAEKAPSSQMKSEKVANV
SAVDPEKVPSLLLKENKRQTELQQTGKKNPSSFTSVNKVNIETIQREKSALEKLPQSQKQ
QTRTDNNGDSDDSASGIEDMSDDSRKMKNDESNKENSSEMGYLENATVIDESALTPEQRL
GLKQAEERLERDHIFRLEKRSPEYTNCRYLCKLCLIHIENIQGAHKHIKEKRHKKNILEK
QEESELRSLPPPSPAHLAALSVAIVEVAKEQGITDDDLKARLEIVEEMSKVITAFLPECS
LRLYGSSLTKFALTSSDVNIDIKFPSTMNHPDLLIQVLGIFKKNVLYVDVESDFHAKVPV
VVCKDRKSGLLCRVSAGNDSACLTTDLLAALSKMEPVFTPLVLAFRYWAKLCYIDSQTDG
GIPSYCFALMAMFFLQQRKPPILPCLLGSWIEGFDPKRMDDFQLKGIVEEKFVKWEYKSS
SATEKNSIAEENKAKADQPKDDTKKTETDNQSNAMKEKHGKSPLTLETPNQVSLGQLWLE
LLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSLNSQLVYEY
VVERFRAAYRYFACPQRKGGNKSTVHFKKKEKGKISNKKPVKSDNMGTSCSVLLGESTEK
INTERSQSDKHDDMECTSQRCINDNDHLLVNELGLADTVQESSSLSIVNEGTELEPKSVK
KLDGLVPSETCFKKELGQCNCIESPDPNESAGTDCRSNLEIETSHQIMCIDTSATSCNCK
ATEVASDLNDDDNLLSQELYYVFDKFILTSGKPPTIVCSICKKDGHSKNDCPEDFRKIDL
KPLPPMTNRFREILDLVCKRCFDELSPPFSEQHNREQILIGLEKFIQKEYDEKARLCLFG
SSKNGFGFRDSDLDICMTLEGHENAEKLNCKEIIENLAKILKRHPGLRNILPITTAKVPI
VKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRG
SLSSYAYILMVLYFLQQRKPPVIPVLQEIFDGKQIPQRMVDGWNAFFFDKTEELKKRLPS
LGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNH
NLGAGVSRKMTNFIMKAFINGRKLFGTPFYPLIGREAEYFFDSRVLTDGELAPNDRCCRV
CGKIGHYMKDCPKRKSSLLFRLKKKDSEEEKEGNEEDKDSRDLLDSRDLHDTRDFRDPRD
LRCFICGDAGHVRRECPEVKLARQRNSSVAAAQLVRNLVNAQQVASSAQQQGDQSIRTRQ
SSECSDSPSYSPQPQPFPQNSSQSTAVTQPPSQSGSQPKLGPSQQGAQASHQVQMPMYNF
PQSPPAQYSPMHNMGLLPMHPLQIPAPSWPIHGPVIHSAPGSAPSSIGLNDPSIIFAQPA
ARPMAIPSSSHDGHWPRTVAPNSLVNNGAVGSSEPGFRGLNPPIPWEHAPRPHFPLVPAS
WPYGLHQNFMHQGNTRFQPNKPFYTQDRCAARRCRERCPHPPRGNVSE
Download sequence
Identical sequences G5AUI6
HGL_H00000257177 XP_012922717.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]