SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000257570-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000257570-1
Domain Number 1 Region: 6-202
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.53e-57
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.0000851
Further Details:      
 
Domain Number 2 Region: 203-348
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.17e-54
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000223
Further Details:      
 
Domain Number 3 Region: 403-506
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.16e-23
Family Ubiquitin-related 0.00011
Further Details:      
 
Domain Number 4 Region: 354-427
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000458
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000257570-1
Sequence length 514
Comment OASL (Homo_sapiens) 2'-5'-oligoadenylate synthetase-like
Sequence
MALAHDLYGTPASRLDSFVAQWLQPSRKWKEEVLEVVRTVEQYLRQEFFYWERGLDQEVR
VLKVVKVGSFGNGTVLRGTTDVELVVFLSCFHSFQEEAKQHQAILRLLRKKVCCCQDLVD
LGLSDLSVAQGVPDALIFTIQAGETEEPINVTIIPAYGVLGPSVPNSKPPPEIYVSLIKA
YGYPGNFSPSFSELQRNFIKHRPTKLKSFLRLVKHWYQQYVKAKCPRANLPPPYALELLA
IYAWEMGTEEEESFSLAEGLTTVMELLQDAELICIYWTKYYTLQHPVIEGAVRKQLKKER
PIILDPADPTHNVAEGYRWDIMAQRACQCLKQDCCYDTNDTPVPAWNVKRARDIQLTVEQ
WGHSDLILRMNPYESIKKLKEKIRRSRGYAGLQRLSFQEPGGERQLLSSHCSLAYYGIFS
DTHICLLDTVSPEIQVFVKNPDGRSHAYATHPYHLILGLKQKIEDRQGLPSKQQQLEFRG
QVLQNWFNFSCYGIQDSDTIILSKKKEEALFPSS
Download sequence
Identical sequences G5AWY0
HGL_H00000257570-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]