SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000257570-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000257570-2
Domain Number 1 Region: 205-346
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.76e-53
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000268
Further Details:      
 
Domain Number 2 Region: 6-204
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 9.81e-50
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.0000501
Further Details:      
 
Domain Number 3 Region: 403-505
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.62e-22
Family Ubiquitin-related 0.002
Further Details:      
 
Domain Number 4 Region: 346-428
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000322
Family Ubiquitin-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000257570-2
Sequence length 506
Comment OASL (Homo_sapiens) 2'-5'-oligoadenylate synthetase-like
Sequence
MDLTPDLYETTGDRLDAFLEHSLQPQGDWKEEMQDAWQRVERFFQNLCFRDLLVLDEEVR
VLKVVKGGSLGKGTTLNHSSDLDMVLFLSCFTSFQKQASLRGFIIDFIEKRFDHCSESLA
YNIAVVHHRPGPREPRSLTLQVHPRKSSDVIRMDVVLAFDALGSLCLDSKPAPEIYEDLI
KSCSHPGEFSPSFTVLQRDFVKRRPIKLKNLLRLVKFWYLKYVKPQYRKVALPPKYALEL
LTIYAWEMGTDQQENFNMDEGLLAVMTLLRDYEDICIYWTKYYDFQSEIVRNFIKQQLKK
SRPIILDPADPTNNLGKGRRWDLVAKEAAYCLQQACCLTEDPSQAWHVQQARDVQVTVKQ
AGKEDWTLSVDPYSPIRKMKAEIKMRNDICGYQRLSFQEPGGQRQLLGSRQTLAHYGIFS
KVNIRVLETSLDEIQVFVKDSSGQSRPYAINPDDTILDLKEVIEEAGGPCVEDQILKFQG
RKLKNDQCLEDLEIKDCDTILLIRRS
Download sequence
Identical sequences G5AWY1
HGL_H00000257570-2 XP_004843697.2.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]