SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000257962 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000257962
Domain Number 1 Region: 592-721
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000108
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000257962
Sequence length 737
Comment SLC26A10 (Homo_sapiens) solute carrier family 26, member 10
Sequence
MSGLPGTSTCSGPGKDSDLKSPLGTRLREPLTEARFQQLFGGAEQEPEPPAEPCVPKLCR
LWRLWARACSGPGAWRLLLARLPPLCWLPHYRWRAWLLGDVVAGVTVGVVHVPQGMAFAL
LTSVPPVFGLYTSFFPVLIYSLLGTGRHLSTVPDPLEGNLSRIEREQLDAQRVGVAAAMA
FGSGALMVKEDQGSALGDASTLGVWGGDWASEEGGATSRTASPPQLGMFVLQLGVLSTFL
SEPVVKALTSGAALHVLVSQLPSLLGLSLPRQMGCFSLFKTLAAVVTALPRSGLAELTIS
ALSLALLVPVKELNVRFRDRLPTPIPGEVVMVLLASLLCFTSSLDTRYNVQIVGLLPGGF
PQPHLPNLDELPRILADSLPIALVTFAVSASLASIYADKYSYSIDPNQELLAHGVSNLIS
SLFSCFPNSATLATTSLLVDAGGNTQLAGLFSCTVVLLVLLWLGPFFYYLPKAVLACINI
SSMRQMFFQMQELPQLWHISRVDFAVWMVTWVAVVTLNVDLGLAIGMVFSMMMVVCRTQR
WVKMMEREQFVEDDASQARLGWESDPSFFHRVKCLALGLAEGTELYRPLRESHKLLQIPG
LCILSYPTPLYFGTRGQFRRIVEWHLGLGGGKESPKPDALPDTVGEPVRVVILDFSGVTF
ADAAGAREVAQLAGQCQDAGIYLLLAHCNASVLETLIRAGILDRVTPDQLFVSVQDAAAH
ALARLERTGLKICTVWV
Download sequence
Identical sequences G5BEC5
HGL_H00000257962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]