SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000258428 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000258428
Domain Number 1 Region: 398-445,502-701
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.15e-77
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000888
Further Details:      
 
Domain Number 2 Region: 45-130
Classification Level Classification E-value
Superfamily BRCT domain 5.1e-22
Family DNA topoisomerase II binding protein 1, TopBP1 0.047
Further Details:      
 
Domain Number 3 Region: 706-820
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.00000000000000194
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000258428
Sequence length 1252
Comment REV1 (Homo_sapiens) REV1 homolog (S. cerevisiae)
Sequence
MRRGGWRKRAENDWEKWGGYMAAKVQKLEEQFRSDAAMQKDGTSSTIFSGVAIYVNGYTD
PSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLPTAKIKELKGEKVIRPEWIVESIKAG
RLLSYIPYQLYTKQSTAQKSLNFNPICKPEDPVPGPSNVAKQLNNKVNHIIKKIETENEV
RVNGINTWNEEDANHNFSFVDLETPLPGRKQNVIPHPRGSAAILNGHSLSSNGALKTQDC
LVPGGNSIASRLSPPDSAQEKNAEKSNTDFRDCTPQQLQQSTRNSETLRNPHRTNSLSPS
LHSNAKINGAHHSTVQGPSSTKSTSSLPALSKVAPSVPSKPSDCSFISDFYSHSRLHHIS
TWKCELTEFVNTLQRQSSGVFPGREKLKKMKTGRSALVVTDTGNMSVLSSPRPQSCIMHV
DMDCFFVSVGIRNRPDLKGKPVAVTSNRGSGRAPLRPGANPQLEWQYYQNKILKGKAADI
PDSSLWENQDSAQINGIDSVLSKAEIASCSYEARQVGIKNGMFFGHAKQLCPNLQAVPYD
FHAYKEVARMMYETLASYTHNIEAVSCDEALVDITEILAETKLTPDEFANAVRVEIKDKT
KCAASVGIGSNILLARMATRKAKPDGQYHLKPEEVDDFIRGQLVANLPGVGRSMESKLTS
LGIKTCGDLQHMTMAKLQKEFGPKIGQMLYRFCRGLDDRPVRTEKERKSISAEINYGIRF
TQPKEAEAFLLKLSEEIQRRLEAAGMKGKRLTLKIMVRKPGAPVETAKYGGHGICDNIAR
TVTLDQATDSAKIIGKATLNMFHTMKLNISDMRGVGIQVNQLVPTNPNPSTCSSRASAQS
SHFPGGSHSVRDLLQVQKAKKPTEEDSKEVSLAAVDLEASSARRTCTFLPSFSAHLPATV
SADTNKAESSGKWNGLHSPISVQSRLNLSIEVPSSSQLDQSVLEALPSDLREQIEQVCAI
QQGEPSGDKKKEPVNGCNTGILPQPVGTVLLQIPEPQESNSDIGISIIALPAFSQVDPEV
FAALPAALQKELKAAYDQRQRQGEDPTHQQPASASEPKNPSLQLKPVAVKDKKKSKKKTP
ISPPKKIQNPLKNMLLNSPAKTLPGACGSPQKLMDGFLKHEGPAAEKPLEELSASTSGVQ
GLFSLQPAQHSCVRPVAPNLAGAVEFSDVKTLLREWITTISDPMEEDILQVVKYCTDLIE
EKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Download sequence
Identical sequences G5BMS3
HGL_H00000258428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]