SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000258455 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000258455
Domain Number 1 Region: 272-396
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.49e-36
Family Translational machinery components 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000258455
Sequence length 396
Comment MRPS9 (Homo_sapiens) mitochondrial ribosomal protein S9
Sequence
MAAPCVSCSSSLSCRLFLGSRVILARSQEPWKALAAGLQAGTGPQISRLIHTTVVTTKKG
VPASRRETYTEDFIKKQIEEFNIGKRHLAHMMGEDPETFTQEDVDRAITYLFPSGLFEKR
ARPIMKHPEQIFPKQRAIQWGEDGRPFHFLFYTGKQSYYSLMHDLYGKILQVENRRNDLL
PKSLLPETAKVIDLIGSRWLIKEELEEMLVEKLSDQDYTQFVRLLEKLLALPCSPAEQEF
VQRFRRSLAFQSKKHQIQPAQYDEQGVPFSTSEGKRKTARAEAVVSGQGTGRIQVNGVDY
LLYFPVTQDREQLMFPFHFLDRLGKHDVTCTVSGGGRSAQAGAIRLAMARALCSFVSEDE
VEWMRQAGLLTPDPRVRERKKPGQEGARRKFTWKKR
Download sequence
Identical sequences G5AZF3
HGL_H00000258455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]