SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000260947 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000260947
Domain Number 1 Region: 363-487
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-36
Family Ankyrin repeat 0.00027
Further Details:      
 
Domain Number 2 Region: 2-69
Classification Level Classification E-value
Superfamily RING/U-box 2.43e-34
Family RING finger domain, C3HC4 0.0000482
Further Details:      
 
Domain Number 3 Region: 519-619
Classification Level Classification E-value
Superfamily BRCT domain 2.91e-21
Family BRCT domain 0.01
Further Details:      
 
Domain Number 4 Region: 619-724
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000174
Family DNA topoisomerase II binding protein 1, TopBP1 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000260947
Sequence length 725
Comment BARD1 (Homo_sapiens) BRCA1 associated RING domain 1
Sequence
TNILREPVCLGGCEHIFCSDCVSDCIGTRCPVCSTPAWILDVRINRQLDSMIQLYSKLRN
LLHNDKFSDLKEDASRTNLFNDAENKKNSVKMWFSPRSKRVRYVVRKVSVQTKPQKTKDE
NAQQASMYEFVSATPPMVVSKRAKKASTTSAKKQQKKTLAEINQEWNLNREKEDDELDLK
EEFKEKQVSFCSQPAIIGSPKVNGEIDLLASGSVTELESCGSLTEVFLPLAEHIESPDND
NMIEVSPEKACENDLTSKTSLPLGHNGKRGPCNRLSSPVSKKCRSSIPSTSGDVVRQTVL
SENIALLDCSSPASGTLKVDDTLRRENDNVSDDSISLSPCTLPSTLNSSSYRRLMSSPSA
MKLYPHGFMARKRNHRGETLLHIASIKGDVSSVEYLLQNGTDPNVKDNAGWTPLHEACNH
GHLKVAELLLQHKALVNTTGYQNDSPLHDAARNGHLDIVRLLLSCGASRNAVNIFGLRPV
DCTDSENMKSLLLLPEKNESFSTSHCSVNTGQRRDGPLVLIGSGLSSEQQKMLGELAAIL
KAKKCTEFDSTVTHVIIPGNEAQSTLKCMLGILNGCWVLKFDWVKACLQRKVCDQEEKYE
IPEGPQRSRLNREQMLPKLFDGCYFYFGGTFKHHPKDNLIRLVAAAGGQVLSRKPKPDSD
VTQTINTVAYHAKPNSDQRFCTQYIIYEDLSNYRPERVRQGKVWMAPSSWFINCVMSFKV
LPLDS
Download sequence
Identical sequences G5BHR8
HGL_H00000260947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]