SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000261888 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000261888
Domain Number 1 Region: 95-275
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.3e-40
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000261888
Sequence length 322
Comment PARP16 (Homo_sapiens) poly (ADP-ribose) polymerase family, member 16
Sequence
MQPSGRTAAQEATGRDVLAADLRCSLFAAALRSYKRDSMLRPFPAAYARGDCKDFEALLA
DASKLPSVKELLKSSGEEDQWAWDLVSWILTSKVLTVHSAGKTEFEKIQQLTGTPHTPVP
VPDFLFEIEYFNPANAKFYETKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEG
TYLTSDLSLALIYSPHSHGWQHSLLGPILSCVAVCEVIDHPDVKCQIKKKDSKEIDRRRA
RIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSLKQPKRASSHLSWVSSHWFVVMMSLYLL
LLLIVSVINSSAFQHFWNRVKR
Download sequence
Identical sequences G5AN60
HGL_H00000261888 XP_004855681.1.39548 XP_004855682.1.39548 XP_004855683.1.39548 XP_012931708.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]