SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262177-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262177-2
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.96e-28
Family Chaperone J-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262177-2
Sequence length 107
Comment DNAJB6 (Homo_sapiens) DnaJ (Hsp40) homolog, subfamily B, member 6
Sequence
MVDYYEVPGVPRQASSEAIKKAYRKLALKWHPDKTPENKEEAERRFKQVSQGYEVLSNAQ
KRGIYDHYGEAGVDGGASAGEASSVDTFEFVLTFHHAVEVFKEFFGD
Download sequence
Identical sequences G5B0W0
HGL_H00000262177-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]