SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262207 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262207
Domain Number 1 Region: 54-221
Classification Level Classification E-value
Superfamily PR-1-like 3.79e-51
Family PR-1-like 0.0001
Further Details:      
 
Domain Number 2 Region: 289-387
Classification Level Classification E-value
Superfamily LCCL domain 1.44e-29
Family LCCL domain 0.0011
Further Details:      
 
Domain Number 3 Region: 391-495
Classification Level Classification E-value
Superfamily LCCL domain 1.44e-27
Family LCCL domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262207
Sequence length 500
Comment CRISPLD1 (Homo_sapiens) cysteine-rich secretory protein LCCL domain containing 1
Sequence
MKCTAREWLRVTTVLFMAKAIPAMVVPNATLLEKLLEKYMDEDGEWWTAKQRGKRAITDN
DMESILDLHNKLRSQVYPTASNMEYMTWDVELERSAESWAETCLWEHGPASLLPSIGQNL
GAHWGRYRPPTFHVQAWYDEVKDFSYPYEHECNPYCPFRCSGPVCTHYTQVVWATSSRIG
CAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGRPCSACPPSFGGGCRENLC
YKEGSDSYYPPREEETNEIERQQAQVHDTRVRTRSDDSNRNEVISTQQMSQIVSCEIRLR
DQCKGTTCNRYECPAGCLDSKAKVIGSVHYEMQSSICRAAIHYGIIDNEGGWVDITRQGR
KHYFIKSNRNGVQTIGKYQSANSFTVSKVTVQAVTCETTVEQLCPFHKPASHCPRIYCPR
NCMQANPHYARVIGSRVYSDLSSICRAALHSGVIRNHGGYVDVMPVDKKKTYTASFQNGI
FSESLQNPPGGKAFRVFAVV
Download sequence
Identical sequences G5BN26
HGL_H00000262207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]