SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262710 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262710
Domain Number 1 Region: 941-1038
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000255
Family Canonical RBD 0.0068
Further Details:      
 
Domain Number 2 Region: 28-65
Classification Level Classification E-value
Superfamily SAP domain 0.00000256
Family SAP domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262710
Sequence length 1239
Comment ACIN1 (Homo_sapiens) apoptotic chromatin condensation inducer 1
Sequence
MPEAVGTDPSTSRKMAELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSTLVKRLKG
ALMLENLQKHSTPHAAFQPNSQIGEEMSNNSFIKQYLEKQQELLRQRLEREAREAAELEE
ASAESEDEMIHPEGVASLLPPDFQSSLERPELELSRHSPRKGSSVSEEKGESDDEKPRKG
ERRSSRVRQARAAKLSEYSQAAEEEEDQETPSRNLRVRADRNLKTEEEEEEEEEEEEEEE
EDEGQKSGEAPILRQFEEGEEMSRAKPEEVMDERPKTIRSQDQERLERGGRVTRSQEEAR
RGQLARQQQEKDIQTVSPLEEEEREIKSSQGLVKKSQSPSPPRLTEDLGKASLVLQPEQA
ASEEETPPPLLTKEASSPPPHTQLQSEEEIEPMEGPAPPVLIQLSPPSADAETREHTLQV
VGGLSPLSSPTDTKAESPAEKVSEESVLPLVQKSTLAEYSTPKGHEAESQKSAQPFSLKM
EELTPAKEITDESLKQQCLEQTEGQRASHSLFPSHKLKQSADSSSSRSSSSSSSSSRSRS
HSPDSSGSRSYSPPRSKQREVSQARVHANPHARPKTGSRSTSESRSRSRSRSRSASNSSR
KSLSPGVSRDSSTSYTETKDPISGQEVAGPPLAQLQILEPQERTPASSSSIQERHLNQPE
PAEKHVTQRVQPERGSPKKCEAEEAEPPAATQPQTSEIQTSHLPESERIRHVVEEKEEVT
MDTSESRPENEVPEPTLPNADQVSNDDRPEGSAEDEEKKESSLPKSFKRKISVVSATKGV
PAGNSDTEGGQPGRKRRWGASTATTQKKPSISITTESLKSLIPDIKPLAGQEAIVDLHAD
DSRISEDETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEEKEPEAEPAVPPQ
VSVEVALPPPVEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNI
VHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVK
WPQSNPKFLCADYAEQDELDYHRGLLVDQCGSSGQSGNGKWSGGNEHDQSVNGIGTKFER
GHVPAQGPVTAAAKNVRKKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERA
ERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERDRERDRGDR
ERDRDRDRERGRERDRRDTKRHSRSRSRSTPVRDRGGRR
Download sequence
Identical sequences G5ASK3
HGL_H00000262710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]