SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262971 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262971
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily SAP domain 7.78e-18
Family SAP domain 0.00034
Further Details:      
 
Weak hits

Sequence:  HGL_H00000262971
Domain Number - Region: 463-518
Classification Level Classification E-value
Superfamily RING/U-box 0.0224
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262971
Sequence length 692
Comment PIAS4 (Homo_sapiens) protein inhibitor of activated STAT, 4
Sequence
MVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYAKKG
AEPGPQPHRPLDPLTVHSAYERASAVPRTPLSGPNIDYPVLYGKYLNGLGRLPAKTLKPE
VRLVKLPFFNMLDELLKPTELGECCQHCHRLYHIPAMQPGAEDDGPGTTSDPHRPLDPLT
VHSAYERASAVPRTPLSGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFNMLDEL
LKPTELGECCQHCHRLYHIPAMQPGAEDDGPGTTSDVGDAHYVTQQLSMTVPQNNEKLQE
SPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYC
SVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSAALYLVRQLTS
AELLQRLETIGVEHPELCKALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAET
CAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQLIIDGLAAAPQAAFPPARSSSDSSR
LPDPGQVAAAFSGPGYPGPRLLSKILSECEDADEIEFLADGSWCPIRAEKERSCSPQGPI
LVLGTSDTNGLVPTPNVNGSGGMALGSTGVGVGLVGSMENGKLGADVVDLTLDSSSSSEE
EEEEDEEEEEEDEEGPRPKRRCPLPKGLVPAC
Download sequence
Identical sequences G5BZB7
HGL_H00000262971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]