SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263717 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000263717
Domain Number - Region: 276-382
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0706
Family SMI1/KNR4-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263717
Sequence length 430
Comment SPATA1 (Homo_sapiens) spermatogenesis associated 1
Sequence
QLMELHVFYVPEGSWNYKLNTISIEVANKFISAGFIRQVFSSYITKVSPQLTLRALRLRL
GEFLGEDAVAEKFFFLKCIGNNLAVVKERQESELKLKSFAPPYALQPELYLLPVMDHLGN
VYSASSAVTLDGLQTNNDIAEIDGTIQRPVSVTLSKEEPGRIPSSLENILKELFSKNQEE
VKKKATPNKSQNANSHIENSKLPASLEDSNDYFHNQKSQFLWKNEDQIINRRQDNQIGEK
EHVLLLDLIDFPSLPCQRQPVLSSGVTDISLLQSEREKIIEQMKQIKEERRYLERITEEL
IKKAEKLFEQNKLKRYQGCDGWKKKYFETKKITASLEEVLTKLREDLELYYKKLLTQLEA
REIKMKPKNVANIADSKNYLIIQITEVQHAIDQLKRKLDTDKMKLIIEVKMRKQAVSDLR
ALKTELVQKK
Download sequence
Identical sequences G5C927
HGL_H00000263717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]