SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000264263 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000264263
Domain Number 1 Region: 46-334
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.45e-94
Family G proteins 0.000000373
Further Details:      
 
Domain Number 2 Region: 527-647
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-32
Family Translational machinery components 0.00017
Further Details:      
 
Domain Number 3 Region: 651-741
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.26e-24
Family EF-G/eEF-2 domains III and V 0.00061
Further Details:      
 
Domain Number 4 Region: 450-528
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.55e-23
Family EF-G/eEF-2 domains III and V 0.0002
Further Details:      
 
Domain Number 5 Region: 317-442
Classification Level Classification E-value
Superfamily Translation proteins 4.29e-21
Family Elongation factors 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000264263
Sequence length 757
Comment GFM1 (Homo_sapiens) G elongation factor, mitochondrial 1
Sequence
MRVLGAAAAVALCYQPLFRIPAALGWQRKQVNWKFCRWCSSGIIPNEKIRNIGISAHIDS
GKTTLTERVLYYTGRIAQMHEVKGKDGIGAVMDSMELERQRGITIQSAATYTMWKDVNIN
IIDTPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVNHQMKRYNVPFLTFINKLD
RLGSNPARALQQMRSKLNHNAAFMQIPIGLEANFKGIVDLIEERAIYFDGDFGQIVRYDE
IPAELRAAAADHRQELIECVANSDEQLGELFLEEKIPSISDLKAGALKISLILTKLAIRR
ATLSRSFTPVFLGSALKNKGVQPLLDAVLEYLPNPSEVQNYALLNQEDDSQEKTKILMNS
KRDSSHSFVGLAFKLEAGRFGQLTYIRSYQGELKRGDTIYNTRTRKKVRVQRLDVEEVYA
GDICALFGIDCASGDTFTSKDNSGLSMESIHVPDPVISIAMKPSNKNDLDKFSKGIGRFT
REDPTFKVHFDAESKETVVSGMGELHLEIYAQRMEREYGCPCITGKPKVAFRETITAPVP
FDFTHKKQSGGAGQFGKVTGILEPLDPENYTKLEFTDDTFGTNIPKQFISAVEKGFLDAC
EKGPLSGHMLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALASATLCILEPIMAVEV
IAPNEFQGPVIAGINRRHGVITGQDGIEDYFTLYADVPLNNMFGYSTELRSCTEGKGEYT
MEYCRYQPCLPSTQEDLINKYLEATGQLPVKKGKAKN
Download sequence
Identical sequences G5BVR1
HGL_H00000264263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]