SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000264331 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000264331
Domain Number 1 Region: 774-1525
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.24e-248
Family Type II DNA topoisomerase 0.00000000000403
Further Details:      
 
Domain Number 2 Region: 80-309
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-62
Family DNA gyrase/MutL, N-terminal domain 0.000000263
Further Details:      
 
Domain Number 3 Region: 657-768
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.26e-24
Family DNA gyrase/MutL, second domain 0.0001
Further Details:      
 
Domain Number 4 Region: 302-367
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000127
Family DNA gyrase/MutL, second domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000264331
Sequence length 1917
Comment TOP2B (Homo_sapiens) topoisomerase (DNA) II beta 180kDa
Sequence
MVAGKPLPVDQEQWDCGSEAPISGLEAAELSTVVCWSGVLCVFVVWNQTLFDQNNAAKKE
ELEAANKNDSSKKLSVERVYQKKTQLEHILLRPDTYIGSVEPLTQLMWVYDEDVGMNCRE
VTFVPGLYKIFDEILVNAADNKQRDKNMTCIKISIDPESNIISIWNNGKGIPVVEHKVEK
VYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTW
MNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCKGVK
VMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFV
NSIATTKWRILSCDFSKSGFGFLEKLNCYCLSTLFSSTGDLEASDPQQVLAVLMASSQRS
QSCEGSSSSQDAHFSHTLQNVLLNAKLCKLVSFLLKYQKKEQVTMKEMMHVVSHDYRNNF
PLNFWELCESMYLGFGIKIRKVNYSGNTYELVPILGLTYSGILDGDDERIILKIDIIIFV
LSLIFIEGNCISEEDLTEKVKRWDMLAQSERIHFEEAWKFITENLVWEEYLMYRQIPSSD
PAHYEFLWGPRAHAETSKMKLLVHMAHLNGTDPKSYPELYEEALEAKLGIEPGFLRNGIL
HKGGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVKPFQVKNHIWVFINCLIENPTFDSQTK
ENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGI
PKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASH
KQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIH
HNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGT
STAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLH
GLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRND
KREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGK
DAASPRYIFTMLSSLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGT
GWACKLPNYDAREIVNNVRRMLEGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDR
NTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLA
QAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLV
GMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAA
EEEETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRK
SPSDLWKEDLAAFVEELDKVEAQEREDILAGMSGKAIKGKVGKPKVKKLQLEETMPSPYG
RRVVPEITAMKADASKKLLKKKKGDLDTTVVKVEFDEEFSGTPAEGTRVRKTPTASGKPS
AKKVKKRNPWSDDESKSESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDDDADDD
DDDNNDLEELQVKASPIINDGEDEFIPSDGLDKDEYTFSPSKSTPEKSLHDKKNQDFGNL
FSFPSYSQKSEDDSAKFDSNEEDTASVFSPSFGLKQTDKVPSKTVAAKKGKPPLDTASKS
KRAPKQKKVVETINSDSDSEFGVPKKTATPKGKGRGAKKRKASSSENEGDYNPGRKSSKT
TSKKPKKTSFDQDSDVDIFPSDFTSDPPSLPRTGRARKEVKYFAESDEEDVDFAMFN
Download sequence
Identical sequences G5BF97
HGL_H00000264331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]