SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000264717 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000264717
Domain Number 1 Region: 281-526
Classification Level Classification E-value
Superfamily SIS domain 5.19e-17
Family mono-SIS domain 0.0093
Further Details:      
 
Domain Number 2 Region: 29-196
Classification Level Classification E-value
Superfamily SIS domain 0.000000184
Family mono-SIS domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000264717
Sequence length 623
Comment GCKR (Homo_sapiens) glucokinase (hexokinase 4) regulator
Sequence
MPSTKRFQHVIETPKPGEWELSGYEAAMPITEKSNPLTRDLDKADAGKIVQLLGQCDAEI
FQEEGQAMPAYQRLYSESVLTTMLQVAGKVQEVLKEPDEGLVVLSGGGTSGRMAFLMSVS
FNQLMTGLGQKPLYTYLIAGGDRSVVASREGKEDSALHGIEELKKVAAGKKRVIVMAISA
GLSAPFVAGQMDYCMDNIAVFLPVLVGFNPVNMARNDPIEDWSSTFRQVAERMQKMQEKQ
EAFVLNPAVGPEGLSGSSRMKGGSTTKILLETLLLAAHKTVDRGIAASPRCLLEILRTFE
RAHKVTYSQSSKIATLMKQVSTSLEKKGRVHLVGWQNLGIIAIMDGVECIHTFGSDFRDI
RGFLIGDHSDMFNQKAELTNQGPQFTFSQEDFLTSILPSLREIDTVIFIFTLDDNLTEVQ
TLVEQVKEKTSNIQALVHSTVGQSLPAPLKFPSIISIMWPLLFFEYEGNFVQKFQRELST
KWVLNTVSTGAHVLLGKILQNHMLDLHIGNSKLFWRALALLQRFSGQSKALCIESLLQAI
HFPQPLTDEIRAAPISSHIQVAREKKQVIPVALVSLLSRCSIPTAQARVAAAPSVCEAVR
NALAGPGRKRGAEPLEASRPAVQ
Download sequence
Identical sequences G5BA51
HGL_H00000264717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]