SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000264870 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000264870
Domain Number 1 Region: 192-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.75e-117
Family Transglutaminase core 0.0000000000176
Further Details:      
 
Domain Number 2 Region: 8-191
Classification Level Classification E-value
Superfamily E set domains 7.35e-55
Family Transglutaminase N-terminal domain 0.0000000234
Further Details:      
 
Domain Number 3 Region: 518-628
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.7e-30
Family Transglutaminase, two C-terminal domains 0.00000274
Further Details:      
 
Domain Number 4 Region: 630-727
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.58e-28
Family Transglutaminase, two C-terminal domains 0.00000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000264870
Sequence length 731
Comment F13A1 (Homo_sapiens) coagulation factor XIII, A1 polypeptide
Sequence
MSDTARTTFGGRRAMPPNNSNAAEDELPTEELLGLVPRGVNLEDYLTVTDVHLFKEKWDS
NKIDHHTDKYDNSKLIVRRGQSFYIQIDFNRPYDPKKDFFRVEYVIGRYPQENKGTYIPV
PIVSKLQSGKWGAEVIMNEDRSVRLSVQPSPECIVGKFRMYVAVWTPYGILRTRRNPETD
TYILFNPWCEEDAVYLDDEKEREEYVLNDIGVIFYGDFNDIKSRSWSYGQFEDGILDACL
YVMDKAQMDLSGRGNPIKVSRVGSAMINAKDDQGVIVGSWDNVYAYGVPPSAWTGSVDIL
LEYRSSENPVQYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGN
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHMVESVDATHIGKLIVTKQIGGDGIQDITD
TYKFQEGQEEERLALETALMYGARKDMKTEGVVKSRSNVNMDFQVENAVLGKDFKVTITF
QNNSPNRYNVTAYLSGNITFYTGVSKTEFKNETFDVVLEPFSFKQKEVLVRAGEYMGQLL
EQAFLHFFVTARINESKDVLAKQKSTVLIIPKVIIKVRGAAMVGSDMVVTVEFTNPLKET
LQNVWIYLDGPGLLKPKRKMFREIHPNSTVQWEEVCRPWVSGPRKLIASMTSDSLRHVYG
ELDLEIQRRPS
Download sequence
Identical sequences G5BAS8
HGL_H00000264870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]