SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000264926 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000264926
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000053
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Weak hits

Sequence:  HGL_H00000264926
Domain Number - Region: 237-268
Classification Level Classification E-value
Superfamily SAP domain 0.00022
Family SAP domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000264926
Sequence length 485
Comment RAD18 (Homo_sapiens) RAD18 homolog (S. cerevisiae)
Sequence
FQTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVPVTEPDLKNN
RLLDELVKSLKLARNHLLQFALESPPLSPASFSSKKLAVKVQSPGAFRESLKQGNRLMDK
FLIRETGDSTSELLIKENDRKVSHQKETSPSTETKETGFVEKMTLGSSDANRPEIPSTSS
LKQVAKVDCPVCGVNVPENHINKHLDSCLSRDEKKESLRSSVQKRKQLPKTVYNLLSDRD
LKKKLKQHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKTAAEIVEEIENMEKTRMRLE
ASKLNESAMVFTKDQTEEEIDEIHSKYRKKHQNEFQLLVDQAKKGYKKTGGMSKNKVMKE
EESTGKLLSVCMGPKDDKMKFSDVTSEADHFHPSKLVSPSKSKAKRADDSSSCTDIQEVT
LFSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDIDTSPRQNRRMRAAESAEIEPRN
KRNRN
Download sequence
Identical sequences G5BX95
HGL_H00000264926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]