SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265028-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265028-2
Domain Number 1 Region: 41-138
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.57e-30
Family Chaperone J-domain 0.00033
Further Details:      
 
Domain Number 2 Region: 148-175,223-258
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000432
Family HSP40/DnaJ peptide-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265028-2
Sequence length 259
Comment DNAJB11 (Homo_sapiens) DnaJ (Hsp40) homolog, subfamily B, member 11
Sequence
MKLFGGEIGREEYAGQGPAPRQNLGTFCLLVLNLIGAVIAGRDFYKILGVLCSASIKDIK
KVYRKLALQLHPDRTPDDPQAQEKFQDLGAAYEVLSDSEKWKQYDTYGEEGLKDGHQSSH
GDIFSHFFGDFGFMFVGTPRQQDRNIPRGSDIIVDLEVTLEEVYVGNFVEVVRNKPVARQ
APGKWKCNCRQEMQTTQLGPACFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEH
PFIGEGEPHVDGEPGDLRF
Download sequence
Identical sequences G5C7E8
HGL_H00000265028-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]