SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265094-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265094-2
Domain Number 1 Region: 167-459
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.24e-75
Family WD40-repeat 0.0000000000672
Further Details:      
 
Domain Number 2 Region: 99-181
Classification Level Classification E-value
Superfamily F-box domain 2.75e-22
Family F-box domain 0.0000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265094-2
Sequence length 483
Comment FBXW11 (Homo_sapiens) F-box and WD repeat domain containing 11
Sequence
MEPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYQKEK
DLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAE
NILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMTIESNWRCGRHNLQRIQCRSEN
SKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSD
STVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVL
VGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSG
SSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAP
ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTY
ISR
Download sequence
Identical sequences G5BBX7
HGL_H00000265094-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]