SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265140 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265140
Domain Number 1 Region: 792-913
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-26
Family Ankyrin repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 8-106
Classification Level Classification E-value
Superfamily BRCT domain 9.89e-18
Family BRCT domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265140
Sequence length 1052
Comment ANKRD32 (Homo_sapiens) ankyrin repeat domain 32
Sequence
MEDNAPKHVIQMTGFKMEEKEALGKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAA
CAAGKWVLTKDYIIHSANSGRWLDETTYEWGYKIEKDSHFSPQMQSAPKRWREELKRTGA
PGAFHRWKVVLLVRADKRSDSLLRVLEAGKANVILPKSSPTGITHVIASNARINAEKEKD
NFKAPFYPIQYLGDFLLENGEESQTSSFGSKPGNQEKNKDFRKDMGLFEMKSALRETICR
IRKEMQNHDEDVIVSSAVNERHKRAKFRETRDLKFLKMRNTLGSHTYGNQKETTKKNEDI
QRSYTLRKKLKKEIDCKKDFEHDRIKRTLRKHVYYTDQKEMNNSVFTDYAKESKPKDIRK
DMDISEIKNVLRKHIYRAQAVRYNCIRIEKQPVYNAEVKNAEFPRGILNLIESLIEGQFF
KEAMEELSSLQAHYIPPVCLLHALLDNVLQDNIDTFSGRYFDILSALLRLHPPWKSPAMS
RYYLELFQCPNCTKGAWSLVEALIRSCLFNENFCHEISQNITDSKVLHLTLLKFFFNLVE
SEVQHLSQKLYDCSESHGVKITGKAVLHEIFWSGNETSGLLTKPVNMLLEWTIYSYKEKC
KSDDVFKHELTYLLTGILGATVDYWIFLGLKMGRNVMRHLSDDFGSYISLACDDFSSREL
EIFICSFSSSWLQMFVAEAVFKKLCLQSSIGISSEPLSLQKMVYSYLPALGKTGVHRAGK
VHLPKKTGQRSCLESQRALLMLNGAKRKPVEGPPRFPELNLAKCSPSLKKFKKKSEGESP
CSKENCPNLKKMNIHKTNLKGETALHRACISNKVDKLILLLSLPGIDINVKDNAGWTPLH
EACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGPLLLQQR
NSKGELPLDYVLSPQIKEELFAITKIEDTVENFHVQAEKHFYHQQLEFGSFLLSRMLLNF
CSIFDLSSEFILAFKGLTHLNELLMAYKSYKETTSTHTDWLLDLYDRNIRTLKKLPNILK
ELPEHLKLCPGVHTEALLVTLEMMCRSVTDLS
Download sequence
Identical sequences G5BU37
HGL_H00000265140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]