SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265421 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265421
Domain Number 1 Region: 149-334
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 9.81e-64
Family DNA polymerase beta-like 0.0000000125
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.85e-22
Family DNA polymerase beta, N-terminal domain-like 0.00000485
Further Details:      
 
Domain Number 3 Region: 92-147
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 4.91e-17
Family DNA polymerase beta-like, second domain 0.0000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265421
Sequence length 335
Comment POLB (Homo_sapiens) polymerase (DNA directed), beta
Sequence
MSKRKAPQETLNGGITDMLMELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAK
KLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDMSSSINFLTRVSGIGPSAARKFVDEGIK
TLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLSEVKKLDSEYIATVCGS
FRRGAESSGDMDVLLTHPDFTSESSKQPKLLHHVVEQLQKIHFITDTLSKGETKFMGVCQ
LPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEQGFTINEYTIRP
LGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Download sequence
Identical sequences G5BT41
XP_004855336.1.39548 HGL_H00000265421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]