SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265564 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265564
Domain Number 1 Region: 274-364
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.83e-25
Family Ribonuclease PH domain 2-like 0.00000504
Further Details:      
 
Domain Number 2 Region: 156-253,288-303
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.87e-23
Family Ribonuclease PH domain 1-like 0.0000108
Further Details:      
 
Domain Number 3 Region: 18-94
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.01e-18
Family Ribonuclease PH domain 1-like 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265564
Sequence length 373
Comment EXOSC7 (Homo_sapiens) exosome component 7
Sequence
MRQPRRPCGAGSRPRAVSLTQEDLRVDGRSCEDYRCAEVETGVVSNTSGSARVQLGHTDI
LVGVKAEMGTPKLEKPDEGYLEFFVDWEGLASTSVCNPASEASVDNGLAAALGCPYRTGE
HSLWQARLRSALRGLPWEGASEQPGRSWLLEAASLPAQELLLASSSSSASATPEFEGRGG
DDLGTEIASTLYRIFSSRSSVDLQSLCISPREHCWVLYVDVLLLECGGNLFDAISLAVKA
ALFNTRIPKVRVLEDEEGSKDIELSDDPYDCMQLSVENVPCIVTLCKIGCRHVVDATLQE
EACSLASLLVAVTSSGVVTCMRKVGKGSLDPESIFEMMETGKRVGKVQHTTLQDILHKEE
SLGPRRQKVGFLG
Download sequence
Identical sequences G5ANM9
HGL_H00000265564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]