SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265715 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265715
Domain Number 1 Region: 508-581
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000981
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265715
Sequence length 630
Comment SLC26A4 (Homo_sapiens) solute carrier family 26, member 4
Sequence
MAAPGSRSEPPPLPECSYAVSRPVYSELLFQQRHERRLQERRTLRDSLARSCSCSRKRAL
GVLKSLLPVLDWLPKYRVKDWLLSDVISGVSTGLVGTLQGPFPVVSLMVGSVVLSMAPDE
RFITPSSNGSALNTTMLNTVNTEARDAARVLIASTLTLLVGIIQLVFGSLQIGFIVRYLA
DPLVGGFTTAAAFQVLVSQLKIVLNVSTKNYNGVLSIIYTLIEIFQNIGNTNLADFIAGL
LTIIVCMAVKELNDRFKHKIPVPIPIEVIVEFIAFGISNIFSGFFSCFVATTALSRTAVQ
ESTGGKTQIAGIISAGIVMIAIVSLGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWR
QNKTDAVIWVFTCVMSIILGLDLGLLAGLLFGLLTVVLRVQFPSWNDLGNIPSTDIYKST
KNYKNVGFDAIRVYNKRLKALRRIQKLITKGQLKATKNGIISDAGSSNNAFEPDEDIEDP
QELDIPTKEIEFQVDWNADLPVKVNVPKVPIHSLVLDCGAISFLDVVGVRSLRMIVKEFQ
RIDVNVYFASLQDHVIKQMEQCGFFDDNSRKDIFFLTIHDAILYLQNQVKAQEGQDSILE
TITLMQDCKDPLELMEGKMAQEELDVQEEV
Download sequence
Identical sequences G5C2C9
HGL_H00000265715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]