SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265849 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265849
Domain Number 1 Region: 36-236
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.32e-54
Family DNA gyrase/MutL, N-terminal domain 0.0000000117
Further Details:      
 
Domain Number 2 Region: 216-371
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.72e-36
Family DNA gyrase/MutL, second domain 0.0000025
Further Details:      
 
Domain Number 3 Region: 684-862
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 2.75e-24
Family DNA mismatch repair protein MutL 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265849
Sequence length 870
Comment PMS2 (Homo_sapiens) PMS2 postmeiotic segregation increased 2 (S. cerevisiae)
Sequence
MRDAGFSRSDAFRRSTEPAKAIKAIDGKSVHQICSGQVVLSLSTAVKELVENSVDAGATN
IDLRLKDYGVDLIEVSDNGCGVEEENFEALALKHHTSKIQEFADLTLVETFGFRGEALSS
LCALSDVTISTCHMSAKVGTRLVFDHNGKIVQKTPCPRPKGTTVSVQQLFYTLPVRHKEF
QRNIKKEYARMVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTSGSTSLKENIGSVFGQ
KQLQSLLPFVQLPPSESVCEEYGLSCSDTLPDLFHISGFVSRGTHGVGRSAADRQFFFIN
RRPCDPAKVSRLVNEVYHMYNRHQYPFVVLNISVDSECVDINVTPDKRQILLQEEKLLLA
ILKTSLIGMFDGDVNKLTVNQQPLLDNEGNLVKMDAAEMEKPQLEKQTNSLSLRARGEER
RAVSISRLREAFSLSHSTDTKSWGLETADRRWNSLRVNGGAPSFDSPDPVSAWGLLGPQE
EVISPKKGSGDSVDRAETEEDLGHSSTSAGSKEGFSTPEARSQCSSDQAASSPEDRFPQG
SVDSCEQLLDTDRHPSGMRYHLDQDIGYKFRALPVQTDFSSSDTKRFKKEEIPSIADIPQ
KLVSTQNMSGTQVDVAVKISKKIVPLTFSMSTLAKRINQLHHQKQQNEGEQNYRRFRAKI
CPGENQAAEDELRKEISKTMFAEMEIVGQFNLGFIVTKLKEDIFLVDQHAADEKYNFEML
QQHTALQAQKLIAPQTLNLTAINEAVLIENLEIFRKNGFDFVIDESAPVTKRAKLISLPT
SKNWTFGPQDIDELIFMLSDSPGVMCRPSRVRQMFASRACRKSVMIGTALNTSEMKKLIV
HMGEMDHPWNCPHGRPTMRHIANLEVISQN
Download sequence
Identical sequences G5BF34
HGL_H00000265849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]