SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265872-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265872-1
Domain Number 1 Region: 635-673
Classification Level Classification E-value
Superfamily SAP domain 0.000000256
Family SAP domain 0.0024
Further Details:      
 
Domain Number 2 Region: 924-968
Classification Level Classification E-value
Superfamily EF-hand 0.0000277
Family Calmodulin-like 0.064
Further Details:      
 
Domain Number 3 Region: 146-207
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000445
Family Cold shock DNA-binding domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265872-1
Sequence length 1125
Comment CCAR1 (Homo_sapiens) cell division cycle and apoptosis regulator 1
Sequence
MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTLYTQQTALAAAGLTTQTPAN
YQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLS
TPQPAAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTP
QVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPPAVLQPIAPQTTFGVQA
QPQPQSLLQAQISAASLTPLLQTQPQPLLQQPQQKAGLLQPPVRIVSQPQPARRLDPPSR
FSGRNDRGDQVPNRKDDRSRERERERRRSRERSPQRKRSRERSPRRERERSPRRVRRVVP
RYTVQFSKFSLDCRSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFY
VMHREVESLEKNMAVLDPPDADHFYIVKVMLMASPSMEDLYHKSCALAEDPQELRDGFQH
PARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCT
QWYRFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEK
LQGERKEADGEQDEEEKDDGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKS
QLIARLTKQLKVEEQKEEQKELEKSEKEEEEEDDRKSEDDKEEEERKRQEEMERQRRERR
YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQR
DFGVRIYKSLLSLPEKEDKKEKDKKSKKDERKDKKEERDDETDEPKPKRRKSGDDKDKKE
DKDERKKEDKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDDEDDHDEEEMNKRDDKRDIN
RYCKEKPSKDKEKEKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQ
VKKLLNKVVLRESCFYRKLTDTSKDEENHEESESLQEDMLGNRLLLPTPTVKQELKDIEE
NVGLIVYNGAMVDVGSLLTKLEKSEKVRAEVEQKLQLLEEKTDEDQKTILNLEISNKNLS
GELREVKKDLNQLQENLKVSENMNLQFENQLNKTIRNLSTVMDEI
Download sequence
Identical sequences G5B800
HGL_H00000265872-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]