SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000266087 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000266087
Domain Number 1 Region: 287-363
Classification Level Classification E-value
Superfamily F-box domain 5.63e-18
Family F-box domain 0.0029
Further Details:      
 
Weak hits

Sequence:  HGL_H00000266087
Domain Number - Region: 14-55
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0015
Family Ubiquitin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000266087
Sequence length 483
Comment FBXO7 (Homo_sapiens) F-box protein 7
Sequence
SSDIRYAITLNNKDALTGDEETLASYGIVSGDLICLVLEDAMPAPNLPPSTDSEHFSVPN
NDQPSLAATSSQASIPDERQSDSFQGQAAQSGVGHDDSMVGPSQSVSPKAEEDAMDMEEG
PGVCPSEPMLCSEAAEGQVPHSLETLYQSASCSSASDALTVLIHLLMVESGYLPQGTEAK
AVSMPEKWKASGVYRLQYTHPLCEGSSAALACVPLGSLLIVNATLKISSAIKSVKRLQLL
PSSFICTEEPGENAAEVYKGLQKLSRLFKDQLVYPLLASTRQALNLPDVFGLAVLPLELK
LRIFRLLDVRSVLSLSAVCRDLLSASNDPLLWRCLYLRDFRDGSVRVRDTDWKELYKKRH
RHRKEAQRARHAKFLPPPPHPIPFYPSPLHPSPFAPSSLLPPGIIGGEYDERPALPYVGD
PINSLIPGPGETPGQFPPLRPRFDPIGPFPGPSPVLPGRGGTGDRVPFRPGRGRASDSRM
SFM
Download sequence
Identical sequences G5BPE3
HGL_H00000266087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]