SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000266712 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000266712
Domain Number 1 Region: 422-645
Classification Level Classification E-value
Superfamily TPR-like 1.74e-31
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 661-800
Classification Level Classification E-value
Superfamily TPR-like 1.03e-21
Family Tetratricopeptide repeat (TPR) 0.0079
Further Details:      
 
Weak hits

Sequence:  HGL_H00000266712
Domain Number - Region: 180-241
Classification Level Classification E-value
Superfamily SIS domain 0.063
Family mono-SIS domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000266712
Sequence length 914
Comment TMTC3 (Homo_sapiens) transmembrane and tetratricopeptide repeat containing 3
Sequence
MADINLKEVTLIVGVVIACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYMFSELNPMSYHLLNMIFHAMVSVVFLKVCKLFLDNKSG
LIAALLFVVHPVHTEAVTGVVGRAELLSSIFFLAAFLSYTKSKGPDNSIVWTPIALTVIL
VAIATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTTAAQFLRGKSSIPFCLLQTLIKLI
VLIFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSDL
CCDWTMGTIPLIESFLDIRNLATFAFFCFLGVLGIFSLRYPGDSSKTVLMALCLIALPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISNKSAFKKLSWACLSVVILTHALK
TLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQPDDI
GAHMNVGRTYKNLNRTREAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRA
NESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLW
YNLAIVYIELKEPNEALKNFNHALELNPRHKLALFNSAILMQESGEVKLRPEARKRLLNY
VNEEPLDANGYFNLGMLAMDDKKDTEAEIWMKKAIKLQANFRSALFNLALLYSQTAKELK
ALPILEELLKYYPDHIKGLILKGDILMNQKKDILGAKKCFEKILEMDPTNVQGKHNLCVV
YFEEKDLLKAERCLVETLSLAPHEEYIQRHLNIVRDKISSGFVEQPVLPPGKNTDEEGEN
LIPAEDVKEIRSESRPTQITETSDDKSQSKPNKQLQKNTDKEVPQKTKDIKEIEKKRVAA
LKRLEEIERILNGE
Download sequence
Identical sequences G5BAP9
XP_004867598.1.39548 HGL_H00000266712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]