SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000268206 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000268206
Domain Number 1 Region: 5-181,217-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.81e-95
Family G proteins 0.000000441
Further Details:      
 
Domain Number 2 Region: 689-697,734-773,800-900,959-988
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.12e-32
Family Translational machinery components 0.0086
Further Details:      
 
Domain Number 3 Region: 991-1103
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.11e-30
Family EF-G/eEF-2 domains III and V 0.00052
Further Details:      
 
Domain Number 4 Region: 366-421,500-606
Classification Level Classification E-value
Superfamily Translation proteins 1.34e-20
Family Elongation factors 0.0014
Further Details:      
 
Domain Number 5 Region: 613-687
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.76e-18
Family EF-G/eEF-2 domains III and V 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000268206
Sequence length 1127
Comment EFTUD1 (Homo_sapiens) elongation factor Tu GTP binding domain containing 1
Sequence
MVLNSLDKMIELQKNTANIRNICVLAHVDHGKTTLADCLISSNGIISSRLAGKLRYMDSR
EDEQIRGITMKSSAISLHYTKDNEEYLINLIDSPGHVDFSSEVSTAVRICDGCIIVVDAV
EGVCPQTQAVLRQAWLENIRPVLVINKIDRLIVELKFTPQEAYSHLKNILEQINALTGTL
FTSKVLEERAERETDSQVNPNSEQGEQVYDWSTGLEDTDDSHLYFSPEQGNVVFASAIDG
WGFGIEHFAKIYSKKIGIKKEVLLKTLWGDYYINMKAKKIMKGDQAKGKKPLFVQLILEN
IWSLYDAVLKKDKEKIEKIMTSLGLKIGAREARHSDPKVQINAICSQWLPISHAVLSMVC
QKLPSPLDIASERVEKLMCTGSQTFDSLPLETQALKGAFMKCESEDTAPVIIFVSKMFAV
DAKALPQNKPRPLTQDEIAQRRERARQRHAEKLAVAQGQGRVEPNLNGGILETSPQEEPR
GDKQQVESGAPNPAPQEEDSQESFIAFARVFSGVARRGRKIFVLGPKYSPVEFLQRVPSG
FSTSPDNLPTVPHMACCTLENLYLLMGRELEELEEVPPGNVLGIGGLQDFVLKSATLCSL
PSCPPFIPLSFEATPIVRVAVEPKHPSEMPQLVKGMKLLNQADPCVQILIQETGEHVLVT
AGEVHLQRCLDDLKERFAKIHISVSEPIIPFRETITKPPKVDMVNEEIGKQQKVAVIHQT
REDQSKIPEGVQVDSDGLITITTPNKLATLSVRAIPLPEEVTQILEENSDLIRSVEQLTS
SLDDGKNTQMIHQKTQEKMWEFKRKLEQHLTGRKWRNTIDQIWSFGPRKCGPNILVSRSV
DFQNSVWTGAAGRASQAASRYRDLGNSIVSGFQLATLSGPMCEEPLMGVCFVLEKWDISK
LEEQGASDNQNREHNYVVEEGQEGDRRCPSGDENQELPDGCSEVSEKRTSQKGEPSVTDC
YGPFSGQLIATMKEACRYALQVKPQRLMAAMYTCDIMATSDVLGRVYAVLSKREGRVLQE
EMKEGTDMFIIKAVLPVAESFGFADEIRKRTSGLASPQLVFSHWEIIPSDPFWVPTTEEE
YLHFGEKADSENQARKYMNAVRKRKGLHVEEKIVEHAEKQRTLSKNK
Download sequence
Identical sequences G5BEZ7
HGL_H00000268206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]