SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000269577 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000269577
Domain Number 1 Region: 395-1149
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.57e-248
Family Type II DNA topoisomerase 0.00000000000464
Further Details:      
 
Domain Number 2 Region: 31-228
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.04e-47
Family DNA gyrase/MutL, N-terminal domain 0.00000176
Further Details:      
 
Domain Number 3 Region: 219-380
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.47e-41
Family DNA gyrase/MutL, second domain 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000269577
Sequence length 1491
Comment TOP2A (Homo_sapiens) topoisomerase (DNA) II alpha 170kDa
Sequence
SPRHGQPLNENMEMNKMKKNEDAKKRLSIERIYQKKTQLEHILLRPDTYIGSVELVTQQM
WVYDEDIGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNN
GKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKTWRDNMGRAGEMELKPFSGEDYTC
ITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLK
DKLDETGNPLKVIHEQVNHRWEVCLTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTK
LVDVVKKKNKGGVAVKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQAKSFGSTCQLSE
KFIKAAIGCGIVESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGSRNSTECT
LILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGL
QYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITP
IVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRI
QFKYSGPEDDAAISLAFSKKQIDDRKDWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYN
DFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSS
YHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARL
LFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLVNGAEGIGTGWSCKIPNFDVREVVNNI
RRLMDGEEPLPMLPSYKNFRGTIEELAPNQYVINGEVAILNSTTIEISELPIRTWTQTYK
EQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEAERAGLHKVFKLQTSLT
CNSMVLFDHVGCLKKYDTALDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFIL
EKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEDNEESDSEKETAKGD
SAADTGPTFAYLLDMPLWYLTKEKKDELCKQRSEKEQELHTLKKKSPSDLWKEDLAAFVE
ELEAVEAKEKQDEQVGLPGKGGKPKGKKAQMAEVLPSQQGTRVIPRVTVEMKAEAEKKIK
KKIKSENTEGTPAEDSVELESLKQRLEKKQKREPGARAKKQTTLPFKPIRKGKKRNPWSD
SESDMSSTESNFDVPPREIEPRRAAAKTKFTMDLDSDEDFSDSDEKAEEDDFVPSDASPP
KAKTPPKFTKREPKPQKITVSVTGLEAAGAEDREPPADLPAQPEATKPPPERSATMKKTT
AKGQSSASTAGTKKRAAPKGAKKDPALNSEASAKPDPAKTKYRRKRKPSTSDDSDSNFEK
IISKGATSKKSKAESDDFQMALDSSVTPRAKSGRTKKPIKYLEDSDDDDLF
Download sequence
Identical sequences G5AX78
HGL_H00000269577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]