SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000272418 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000272418
Domain Number 1 Region: 289-368
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.38e-20
Family Translational machinery components 0.009
Further Details:      
 
Domain Number 2 Region: 215-286
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.34e-16
Family Ribosomal S5 protein, N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000272418
Sequence length 431
Comment MRPS5 (Homo_sapiens) mitochondrial ribosomal protein S5
Sequence
MAVSVRAVRCLPALCGVPAGHFWSRQLSVSAFPTTSVLALKATTLSNGTLSPRGSRNDHH
FTSLSCALQTQCCVSSSRNLMGQQCRPYSFFTKLTADELWKGALAETGAGARKGRGKRTK
KKRRKDLNRGQIIGEGHSGFLWPGLNAPLMKNGDVQTIAQRRKEEQEKVEADMLQQREEW
DRKRKIKVKRERGWSGHTWGGVSLGPPDPGPNGETYEDFDTRILEVRNVFNMTAKDGRKK
SIRVLVVVGNGKGVAGFAIGKATERVDAFRKAKNRAVHYLHYIERYEDHTIFHDISLRFK
RTHIKMKKQPRGYGLCCHRAIITICRLIGIKDMYAKVSGSINMLNLTQGLFQGLARQETH
QHLADKKGLHVVEFREECGPLPIVVASPQGALRKDPEPEDEVPDIKLDWQEVKAAQGMKR
SVWSGLKRAAT
Download sequence
Identical sequences G5APT1
HGL_H00000272418 XP_004844395.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]