SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000273628 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000273628
Domain Number 1 Region: 124-166
Classification Level Classification E-value
Superfamily SAP domain 0.000000000000275
Family SAP domain 0.0086
Further Details:      
 
Weak hits

Sequence:  HGL_H00000273628
Domain Number - Region: 26-106
Classification Level Classification E-value
Superfamily Saposin 0.0157
Family Ameobapore A 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000273628
Sequence length 179
Comment MANF (Homo_sapiens) mesencephalic astrocyte-derived neurotrophic factor
Sequence
MWALHSLVVALALSVLPGSWALRPGDCEVCISYLGRFYQDLKDRDVTFSPTTIEKELIKF
CREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDK
QIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL
Download sequence
Identical sequences G5BZT9
HGL_H00000273628 XP_004834220.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]