SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000275461 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000275461
Domain Number 1 Region: 108-168
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.4e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000275461
Sequence length 172
Comment FERD3L (Homo_sapiens) Fer3-like (Drosophila)
Sequence
MAAYPESCVDATVLGFVADLSLASPRHPLLCDFPPGAPFGEPALELPEGSPRRLGQLEEG
GADEEEGEVDGGDEEEEEEDDDDDDDGRGRVASLLGRPKRKRVITYAQRQAANIRERKRM
FNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSCERKEAG
Download sequence
Identical sequences G5BZJ1
HGL_H00000275461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]