SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000275764 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000275764
Domain Number 1 Region: 135-192
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000301
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000275764
Sequence length 499
Comment STRA8 (Homo_sapiens) stimulated by retinoic acid gene 8 homolog (mouse)
Sequence
MSLWVTPGSHISVALLFLSVKRRPNARRYDPYCTVTAPLSPPRRRCECISHAAWLLRDGK
GGSQLYYWESQTTSCLGISEVNSGNLYKQQSTERVKRHITLQLRMSTSGEGSHPGGTVPQ
PMMQVQELEPRVARRRLSQARHRATMAGLFDNLRKIVYSKAELTASKWQVLNKAKNHIQE
LEGTLDTLLKLKASFNLDDGNAHSLKEVKEEYAAVFSGNESLISDSFLQNGSFPWHPTEG
VEKGVEEEEGEEEEEENQEEAEEEEEGKQMDLVHSLSTSPPDLLEFERYLNFYKQTMDLL
IQNGIVSSRMASQPVISAAISHLWQTLSEDRKASVLQAWIQQHSGLLDLGTGPQQAFAED
SMKDSGVDSQGASSSLVSTQEEVLLEDAFDVASFLDKSEIPSTSDPSSVFAGFDPENSEK
KLQFYLQIIDFLEGLCCVNTQLKQDNFCSPKADTAAYDDTAVGVLAKKSVPEAPKERAPP
VDEEMLLLRCLETFDDDDL
Download sequence
Identical sequences G5BS15
HGL_H00000275764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]