SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000276326 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000276326
Domain Number 1 Region: 227-328
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000719
Family F-box domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000276326
Sequence length 366
Comment FBXO25 (Homo_sapiens) F-box protein 25
Sequence
MPFLGQDWRSPGWSWIKTEDGWKRCDSLSQELERENSQCTVTHGLILNSEDEIFSNEECE
YASKKRKKDHFRNDTNAQSFYREKWIYVHKESTRERHGYCTLGEAFNRLDFSSAIQDIRR
FTYVVKLLQLIAKSQLTSLSGVAQKNYFNVLDKIVQKVLDDHQNPRLIKDLLQDLSSTLC
ILIRGVGKSVLVGNINIWICRLETVLGWQQQLQNLQMTKHVNSGLTLSDLPLHMLNNILY
RFSDGWDIVTLGQVTPTLYVLSEDRQLWKKLCQYHFAEQQFCRHLILSEKGHIEWKLMYF
TLQKYYPTKEQYGDTLHFCRHCSILFWKDYHLAWLFKDSGHPCTAADPDSCFTPVSPQHF
IDLFKF
Download sequence
Identical sequences G5AYM3
HGL_H00000276326 XP_004869604.1.39548 XP_004869608.1.39548 XP_012922831.1.39548 XP_012922832.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]