SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000278568 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000278568
Domain Number 1 Region: 261-522
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-87
Family Protein kinases, catalytic subunit 0.000000000204
Further Details:      
 
Weak hits

Sequence:  HGL_H00000278568
Domain Number - Region: 79-182
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0445
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000278568
Sequence length 545
Comment PAK1 (Homo_sapiens) p21 protein (Cdc42/Rac)-activated kinase 1
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSPNTLNVKTVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTILPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
Download sequence
Identical sequences G5AW75
XP_012922873.1.39548 XP_012922874.1.39548 XP_012922875.1.39548 XP_012922876.1.39548 XP_012922877.1.39548 XP_012922878.1.39548 XP_012922879.1.39548 XP_012922880.1.39548 XP_012922881.1.39548 HGL_H00000278568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]