SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000281047 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000281047
Domain Number 1 Region: 116-184
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000281047
Sequence length 199
Comment MSGN1 (Homo_sapiens) mesogenin 1
Sequence
MDTLQEPFFGLAEGLDSSDSPGLLSSWDWKNRARPFALSQASPPPTLSPVSSLESYSPSA
RPVGARLLCGQSGAGGGGSDGHSSRDPGGLVEVDYSMLAFQPAYLQGAGGPKAQKGPKVK
MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTD
LLNSGREPRPECVSSSLRT
Download sequence
Identical sequences G5AZB2
XP_004839494.1.39548 HGL_H00000281047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]