SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000281474 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000281474
Domain Number - Region: 50-175
Classification Level Classification E-value
Superfamily SPOC domain-like 0.0471
Family Ku80 subunit middle domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000281474
Sequence length 905
Comment BICD1 (Homo_sapiens) bicaudal D homolog 1 (Drosophila)
Sequence
QAFGQSYSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSRAVVTNIQAEN
ERLTAVVQDLKESNEMVELQRIRMKDEIREYKFREARLLQDYTELEEENITLQKLVSTLK
QNQVEYEGLKHEIKRCEEEAVLLNSQLEDALRLKEIAAHQLEEALETLKNEREQKNSLRK
ELAQYVTLGDSHLGLSMDGLKFTEDGAEPNNDDKMNGHGPLARLNGDYRAPALRKGEALH
PVSDLFSELNISEIQKLKQQLMQVEREKAILLANLQESQTQLEHTKGALTEQHERVHQLT
EHVNAMRGLQSSKELRAELDGEKGRDSGEEANDYEVDINGLEILECKYRVAVTEVIDLKA
EIKALKEKYNKSVENYTEEKAKYESKIQMYDEQVTSLEKTTKEGVEKMAHVEKELHKMTS
IANENHNTLNTAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQSRVTRSGSLKGP
DDARGLLSPRLARRGVSSPVETRPSSEPSEVSKENPEASKEPSPTKTPTISPVITAPPSS
PVLDTSDIRKEPMNIYNLNAIIRDQIKHLQKAVDRSVQLSRQRAAARELAPMIDKDKEAL
MEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNE
LKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLAL
TQRLEDLEFDHEQSRRTKGKLGKSKIGSPKVSGEASATAPTIDTYLLHSQGPQTPTMRGS
SGTQRKRQFSPSLCDQSRPRTSGASYLQSLLSVPPDPTSTESFLLKGPPSMRELIQGHRL
SKEKRLTVAPPDCQQPAASVPPQCSQLARRQDYSTASPDAALPEEQPHSGSPCAPLHCLA
KPPCP
Download sequence
Identical sequences G5BW58
HGL_H00000281474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]