SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000282096 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000282096
Domain Number 1 Region: 441-848
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.7e-130
Family PDEase 0.000000000000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000282096
Sequence length 892
Comment PDE3B (Homo_sapiens) phosphodiesterase 3B, cGMP-inhibited
Sequence
MAPSRTCCYSEKAFYLERTYATANLAVPDEDTRYEPVLKYGKGAKTLVPTANGSSDMDAL
GFRPQEAPRRPQLSSTAEEKVPVIRPRRRSSCVSLGETAAGYYGSGKMFRRPSLPCISRE
QNSGGGNGVDLSVLNEARNMVSDLLVDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLT
PFPGFYPCSEIEDPAERGDRKLHKGLSSRNSLPAAQLRRSSGTSGLSPIDQSSRCERSNG
KRPHQEFGISSQGYYLNGPFSSNLLTIPKQRSSSVSLTHHVGLRRAGVLPSLSPVNSPSH
GLVSAGSLTNRSPIEFPDTADFLTKPRVVVHRSLSNFPSTPDFYQHLRNSDSNLCNSCGN
QILKYISTREPDGADLHSGKSGEEDNTIFTEESFNFLEAQEEEAEKRAYRKLILEGDNHL
SEEAQQQNVEQEASLGMTLVEDYNSLIEKMSNWNFQIFELVEKMGEKSGNILSQVMYTLF
QDTGLLEIFKIPTQQFLNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPIPGLQQIH
RGHETGSETDSNGRINPGRIAYISSKSCSVPDESYGCLSSNIPALELMALYVAAAMHDYD
HPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLNLDHVEFKRFRF
LVIEAILATDLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKV
RDLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYD
AAGLLPGQWVEGEEDDDTESSDDEDGEELDTDEEIQDNLNPKPQRRKGRRQIFCQLMHHL
TENHKIWKEIIEEEGKCKAEGNKLQVENTSLPQADEIQVIEEADEEEERQLE
Download sequence
Identical sequences G5BUE1
HGL_H00000282096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]