SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000282999 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000282999
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily SRP19 3.01e-39
Family SRP19 0.000000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000282999
Sequence length 144
Comment SRP19 (Homo_sapiens) signal recognition particle 19kDa
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNA
FLEKNKMYSREWNRDIQYRGRVRVQLKQEDGSLCLGQFPSRKSVMLYAAEMIPKLKTRTQ
KTGGGDPNLQQGEGSKKGKGKKKK
Download sequence
Identical sequences G5BA33
HGL_H00000282999 XP_004841845.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]